SCOP 1.71: Domain d1nf3a_: 1nf3 A:

Lineage for d1nf3a_ (1nf3 A:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (45 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein CDC42 [52619] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52620] (16 PDB entries)

8. Domain d1nf3a_: 1nf3 A: [85594]
   Other proteins in same PDB: d1nf3c_, d1nf3d_

Details for d1nf3a_

PDB Entry: 1nf3, 2.1 Å

PDB Description: structure of cdc42 in a complex with the gtpase-binding domain of the cell polarity protein, par6

SCOP Domain Sequences for d1nf3a_:

Sequence; same for both SEQRES and ATOM records:

>d1nf3a_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens)}
gamgiqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglf
dtagledydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtq
idlrddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaa
leppepkksrrcvl

Timeline for d1nf3a_:

• d1nf3a_ first appeared in SCOP 1.65
  
• d1nf3a_ appears in SCOP 1.69
  
• d1nf3a_ appears in SCOP 1.73
  
• d1nf3a_ appears in the current release, SCOPe 2.08, called d1nf3a1