Lineage for d1nezh_ (1nez H:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 362617Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)
  6. 362711Protein CD8 [48734] (2 species)
  7. 362716Species Mouse (Mus musculus) [TaxId:10090] [48736] (2 PDB entries)
  8. 362718Domain d1nezh_: 1nez H: [85593]
    Other proteins in same PDB: d1neza1, d1neza2, d1nezb_
    complexed with nag

Details for d1nezh_

PDB Entry: 1nez (more details), 2.1 Å

PDB Description: the crystal structure of a tl/cd8aa complex at 2.1a resolution:implications for memory t cell generation, co-receptor preference and affinity

SCOP Domain Sequences for d1nezh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nezh_ b.1.1.1 (H:) CD8 {Mouse (Mus musculus)}
kpqapelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymassh
nkitwdeklnssklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlq

SCOP Domain Coordinates for d1nezh_:

Click to download the PDB-style file with coordinates for d1nezh_.
(The format of our PDB-style files is described here.)

Timeline for d1nezh_: