Class b: All beta proteins [48724] (141 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins) |
Protein CD8 [48734] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [48736] (2 PDB entries) |
Domain d1nezh_: 1nez H: [85593] Other proteins in same PDB: d1neza1, d1neza2, d1nezb_ complexed with nag |
PDB Entry: 1nez (more details), 2.1 Å
SCOP Domain Sequences for d1nezh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nezh_ b.1.1.1 (H:) CD8 {Mouse (Mus musculus)} kpqapelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymassh nkitwdeklnssklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlq
Timeline for d1nezh_:
View in 3D Domains from other chains: (mouse over for more information) d1neza1, d1neza2, d1nezb_, d1nezg_ |