Lineage for d1nezg_ (1nez G:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 929433Protein CD8 [48734] (3 species)
  7. 929442Species Mouse (Mus musculus) [TaxId:10090] [48736] (5 PDB entries)
  8. 929443Domain d1nezg_: 1nez G: [85592]
    Other proteins in same PDB: d1neza1, d1neza2, d1nezb_
    complexed with nag

Details for d1nezg_

PDB Entry: 1nez (more details), 2.1 Å

PDB Description: the crystal structure of a tl/cd8aa complex at 2.1a resolution:implications for memory t cell generation, co-receptor preference and affinity
PDB Compounds: (G:) T-cell surface glycoprotein CD8 alpha chain

SCOPe Domain Sequences for d1nezg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nezg_ b.1.1.1 (G:) CD8 {Mouse (Mus musculus) [TaxId: 10090]}
apelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymasshnki
twdeklnssklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlqkvs
sa

SCOPe Domain Coordinates for d1nezg_:

Click to download the PDB-style file with coordinates for d1nezg_.
(The format of our PDB-style files is described here.)

Timeline for d1nezg_: