Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins) |
Protein CD8 [48734] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [48736] (4 PDB entries) |
Domain d1nezg_: 1nez G: [85592] Other proteins in same PDB: d1neza1, d1neza2, d1nezb_ |
PDB Entry: 1nez (more details), 2.1 Å
SCOP Domain Sequences for d1nezg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nezg_ b.1.1.1 (G:) CD8 {Mouse (Mus musculus) [TaxId: 10090]} apelrifpkkmdaelgqkvdlvcevlgsvsqgcswlfqnsssklpqptfvvymasshnki twdeklnssklfsamrdtnnkyvltlnkfskenegyyfcsvisnsvmyfssvvpvlqkvs sa
Timeline for d1nezg_:
View in 3D Domains from other chains: (mouse over for more information) d1neza1, d1neza2, d1nezb_, d1nezh_ |