SCOP 1.67: Domain d1neza2: 1nez A:1-181

Lineage for d1neza2 (1nez A:1-181)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (11 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (20 species)

7. Species Mouse (Mus musculus), tla(c), H-2 class [TaxId:10090] [89861] (1 PDB entry)

8. Domain d1neza2: 1nez A:1-181 [85590]
   Other proteins in same PDB: d1neza1, d1nezb_, d1nezg_, d1nezh_
   complexed with nag

Details for d1neza2

PDB Entry: 1nez, 2.1 Å

PDB Description: the crystal structure of a tl/cd8aa complex at 2.1a resolution:implications for memory t cell generation, co-receptor preference and affinity

SCOP Domain Sequences for d1neza2:

Sequence; same for both SEQRES and ATOM records:

>d1neza2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), tla(c), H-2 class}
gshslryfytalsrpaisepwyiavgylddtqfarfdsagetgtyklsapwveqegpeyw
areteivtsnaqffrenlqtmldyynlsqngshtiqvmygceveffgslfrayeqhgydg
qdyialnedlktwtaadmaaeitrskweqagytelrrtylegpckdsllrylenrkktqe
c

Timeline for d1neza2:

• d1neza2 first appeared in SCOP 1.65
  
• d1neza2 appears in SCOP 1.69
  
• d1neza2 appears in the current release, SCOPe 2.08