Lineage for d1neza1 (1nez A:182-274)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 654537Protein Class I MHC, alpha-3 domain [88604] (3 species)
  7. 654719Species Mouse (Mus musculus) [TaxId:10090] [88606] (78 PDB entries)
  8. 654756Domain d1neza1: 1nez A:182-274 [85589]
    Other proteins in same PDB: d1neza2, d1nezb_, d1nezg_, d1nezh_
    complexed with nag

Details for d1neza1

PDB Entry: 1nez (more details), 2.1 Å

PDB Description: The Crystal Structure of a TL/CD8aa Complex at 2.1A resolution:Implications for Memory T cell Generation, Co-receptor Preference and Affinity
PDB Compounds: (A:) H-2 class I histocompatibility antigen, TLA(C) alpha chain

SCOP Domain Sequences for d1neza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1neza1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdppkthvthharpegdvtlrcwalgfypahitltwqlngeeliqdtelvetrpagdgtf
qkwaavvvpsgeeqkytchvyheglpepltlrw

SCOP Domain Coordinates for d1neza1:

Click to download the PDB-style file with coordinates for d1neza1.
(The format of our PDB-style files is described here.)

Timeline for d1neza1: