Lineage for d1ndgb2 (1ndg B:414-521)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 289100Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 289192Species Mouse (Mus musculus) [TaxId:10090] [88576] (237 PDB entries)
  8. 289205Domain d1ndgb2: 1ndg B:414-521 [85579]
    Other proteins in same PDB: d1ndga1, d1ndga2, d1ndgb1, d1ndgc_
    a part of Fab HYHEL-8
    complexed with acy; mutant

Details for d1ndgb2

PDB Entry: 1ndg (more details), 1.9 Å

PDB Description: crystal structure of fab fragment of antibody hyhel-8 complexed with its antigen lysozyme

SCOP Domain Sequences for d1ndgb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ndgb2 b.1.1.2 (B:414-521) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstavdkki

SCOP Domain Coordinates for d1ndgb2:

Click to download the PDB-style file with coordinates for d1ndgb2.
(The format of our PDB-style files is described here.)

Timeline for d1ndgb2: