SCOPe 2.08: Domain d1ndgb2: 1ndg B:414-521

Lineage for d1ndgb2 (1ndg B:414-521)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (391 PDB entries)
   Uniprot P01864 # GCAB_MOUSE Ig gamma-2A chain C region secreted form (B allele) ! Uniprot P01863 #GCAA_MOUSE Ig gamma-2A chain C region, A allele; 86% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form) ! Uniprot P01868 # GC1_MOUSE Ig gamma-1 chain C region secreted form ! Uniprot P01864 # GCAB_MOUSE (P01864) Ig gamma-2A chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! Uniprot P01863 # GCAA_MOUSE Ig gamma-2A chain C region, A allele ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01868 # ! GC1_MOUSE Ig gamma-1 chain C region secreted form

8. Domain d1ndgb2: 1ndg B:414-521 [85579]
   Other proteins in same PDB: d1ndga1, d1ndga2, d1ndga3, d1ndgb1, d1ndgc_
   a part of Fab HYHEL-8
   complexed with acy

Details for d1ndgb2

PDB Entry: 1ndg, 1.9 Å

PDB Description: crystal structure of fab fragment of antibody hyhel-8 complexed with its antigen lysozyme

PDB Compounds: (B:) immunoglobulin gamma 1 chain

SCOPe Domain Sequences for d1ndgb2:

Sequence; same for both SEQRES and ATOM records:

>d1ndgb2 b.1.1.2 (B:414-521) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstavdkki

Timeline for d1ndgb2:

• d1ndgb2 first appeared in SCOP 1.65
  
• d1ndgb2 appears in SCOPe 2.07