Lineage for d1nd0h2 (1nd0 H:114-231)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1760578Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)
  7. 1760894Species Mouse (Mus musculus) [TaxId:10090] [88576] (415 PDB entries)
    Uniprot P01864 # GCAB_MOUSE Ig gamma-2A chain C region secreted form (B allele) ! Uniprot P01863 #GCAA_MOUSE Ig gamma-2A chain C region, A allele; 86% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form) ! Uniprot P01868 # GC1_MOUSE Ig gamma-1 chain C region secreted form ! Uniprot P01864 # GCAB_MOUSE (P01864) Ig gamma-2A chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! Uniprot P01863 # GCAA_MOUSE Ig gamma-2A chain C region, A allele ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01868 # ! GC1_MOUSE Ig gamma-1 chain C region secreted form
  8. 1761203Domain d1nd0h2: 1nd0 H:114-231 [85574]
    Other proteins in same PDB: d1nd0a1, d1nd0a2, d1nd0b1, d1nd0c1, d1nd0c2, d1nd0d1, d1nd0e1, d1nd0e2, d1nd0f1, d1nd0g1, d1nd0g2, d1nd0h1
    part of cationic cyclization catalytic Fab 4C6
    complexed with dp4, so4

Details for d1nd0h2

PDB Entry: 1nd0 (more details), 2.45 Å

PDB Description: cationic cyclization antibody 4c6 complex with transition state analog
PDB Compounds: (H:) immunoglobulin igg2a

SCOPe Domain Sequences for d1nd0h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nd0h2 b.1.1.2 (H:114-231) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprgpt

SCOPe Domain Coordinates for d1nd0h2:

Click to download the PDB-style file with coordinates for d1nd0h2.
(The format of our PDB-style files is described here.)

Timeline for d1nd0h2: