SCOP 1.73: Domain d1nd0f2: 1nd0 F:114-231

Lineage for d1nd0f2 (1nd0 F:114-231)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)

8. Domain d1nd0f2: 1nd0 F:114-231 [85570]
   Other proteins in same PDB: d1nd0a1, d1nd0a2, d1nd0b1, d1nd0c1, d1nd0c2, d1nd0d1, d1nd0e1, d1nd0e2, d1nd0f1, d1nd0g1, d1nd0g2, d1nd0h1

Details for d1nd0f2

PDB Entry: 1nd0, 2.45 Å

PDB Description: cationic cyclization antibody 4c6 complex with transition state analog

PDB Compounds: (F:) immunoglobulin igg2a

SCOP Domain Sequences for d1nd0f2:

Sequence; same for both SEQRES and ATOM records:

>d1nd0f2 b.1.1.2 (F:114-231) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprgpt

Timeline for d1nd0f2:

• d1nd0f2 first appeared in SCOP 1.65
  
• d1nd0f2 appears in SCOP 1.71
  
• d1nd0f2 appears in SCOP 1.75
  
• d1nd0f2 appears in the current release, SCOPe 2.08