SCOPe 2.08: Domain d1nd0f1: 1nd0 F:1-113

Lineage for d1nd0f1 (1nd0 F:1-113)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 7.1 [TaxId:10090] [88557] (40 PDB entries)
   Uniprot P18532 # HV61_MOUSE Ig heavy chain V region 1B43 precursor

8. Domain d1nd0f1: 1nd0 F:1-113 [85569]
   Other proteins in same PDB: d1nd0a1, d1nd0a2, d1nd0b2, d1nd0c1, d1nd0c2, d1nd0d2, d1nd0e1, d1nd0e2, d1nd0f2, d1nd0g1, d1nd0g2, d1nd0h2
   part of cationic cyclization catalytic Fab 4C6
   complexed with dp4, so4

Details for d1nd0f1

PDB Entry: 1nd0, 2.45 Å

PDB Description: cationic cyclization antibody 4c6 complex with transition state analog

PDB Compounds: (F:) immunoglobulin igg2a

SCOPe Domain Sequences for d1nd0f1:

Sequence; same for both SEQRES and ATOM records:

>d1nd0f1 b.1.1.1 (F:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1 [TaxId: 10090]}
rvqlqqsgpglvkpsqslsltctvtgysitsdfawnwirqfpgnklewmgyinysgftsh
npslksrisitrdtsknqfflqlnsvttedtatyycagllwydggagswgqgtlvtvsa

Timeline for d1nd0f1:

• d1nd0f1 first appeared in SCOP 1.65
  
• d1nd0f1 appears in SCOPe 2.07