Lineage for d1nd0a1 (1nd0 A:1-107)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1103263Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1104358Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (15 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1104576Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (127 PDB entries)
    Uniprot P01631 #KV2G_MOUSE Ig kappa chain V-II region 26-10; 79% sequence identity ! Uniprot P06310 # KV2F_HUMAN IG KAPPA CHAIN V-II REGION RPMI 6410 PRECURSOR ! Uniprot P03976 # KV2E_MOUSE (P03976) Ig kappa chain V-II region 17S29.1 ! Uniprot P01642 21-115 # ! KV2G_MOUSE IG KAPPA CHAIN V-II REGION 26-10
  8. 1104684Domain d1nd0a1: 1nd0 A:1-107 [85559]
    Other proteins in same PDB: d1nd0a2, d1nd0b1, d1nd0b2, d1nd0c2, d1nd0d1, d1nd0d2, d1nd0e2, d1nd0f1, d1nd0f2, d1nd0g2, d1nd0h1, d1nd0h2
    part of cationic cyclization catalytic Fab 4C6
    complexed with dp4, so4

Details for d1nd0a1

PDB Entry: 1nd0 (more details), 2.45 Å

PDB Description: cationic cyclization antibody 4c6 complex with transition state analog
PDB Compounds: (A:) immunoglobulin igg2a

SCOPe Domain Sequences for d1nd0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nd0a1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]}
dvvmtqspktisvtigqpasisckssqrllnsngktflnwllqrpgqspkrliylgtkld
sgvpdrftgsgsgtdftlkisrveaedlgvyycwqgthfpytfgggtkleik

SCOPe Domain Coordinates for d1nd0a1:

Click to download the PDB-style file with coordinates for d1nd0a1.
(The format of our PDB-style files is described here.)

Timeline for d1nd0a1: