SCOP 1.71: Domain d1ncwh2: 1ncw H:114-231

Lineage for d1ncwh2 (1ncw H:114-231)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (302 PDB entries)

8. Domain d1ncwh2: 1ncw H:114-231 [85556]
   Other proteins in same PDB: d1ncwh1, d1ncwl1, d1ncwl2
   part of cationic cyclization catalytic Fab 4C6
   complexed with bez, gol

Details for d1ncwh2

PDB Entry: 1ncw, 1.3 Å

PDB Description: Cationic Cyclization Antibody 4C6 in Complex with Benzoic Acid

SCOP Domain Sequences for d1ncwh2:

Sequence; same for both SEQRES and ATOM records:

>d1ncwh2 b.1.1.2 (H:114-231) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprgpt

Timeline for d1ncwh2:

• d1ncwh2 first appeared in SCOP 1.65
  
• d1ncwh2 appears in SCOP 1.69
  
• d1ncwh2 appears in SCOP 1.73
  
• d1ncwh2 appears in the current release, SCOPe 2.08