SCOP 1.71: Domain d1ncwh1: 1ncw H:1-113

Lineage for d1ncwh1 (1ncw H:1-113)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 7.1 [TaxId:10090] [88557] (34 PDB entries)

8. Domain d1ncwh1: 1ncw H:1-113 [85555]
   Other proteins in same PDB: d1ncwh2, d1ncwl1, d1ncwl2
   part of cationic cyclization catalytic Fab 4C6
   complexed with bez, gol

Details for d1ncwh1

PDB Entry: 1ncw, 1.3 Å

PDB Description: Cationic Cyclization Antibody 4C6 in Complex with Benzoic Acid

SCOP Domain Sequences for d1ncwh1:

Sequence; same for both SEQRES and ATOM records:

>d1ncwh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1}
rvqlqqsgpglvkpsqslsltctvtgysitsdfawnwirqfpgnklewmgyinysgftsh
npslksrisitrdtsknqfflqlnsvttedtatyycagllwydggagswgqgtlvtvsa

Timeline for d1ncwh1:

• d1ncwh1 first appeared in SCOP 1.65
  
• d1ncwh1 appears in SCOP 1.69
  
• d1ncwh1 appears in SCOP 1.73
  
• d1ncwh1 appears in the current release, SCOPe 2.08