Lineage for d1ncna_ (1ncn A:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 287179Protein CD86 (b7-2), N-terminal domain [63635] (1 species)
  7. 287180Species Human (Homo sapiens) [TaxId:9606] [63636] (2 PDB entries)
  8. 287181Domain d1ncna_: 1ncn A: [85553]

Details for d1ncna_

PDB Entry: 1ncn (more details), 2.7 Å

PDB Description: the receptor-binding domain of human B7-2

SCOP Domain Sequences for d1ncna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ncna_ b.1.1.1 (A:) CD86 (b7-2), N-terminal domain {Human (Homo sapiens)}
mlkiqayfnetadlpcqfansqnqslselvvfwqdqenlvlnevylgkekfdsvhskymg
rtsfdsdswtlrlhnlqikdkglyqciihhkkptgmirihqmnselsvla

SCOP Domain Coordinates for d1ncna_:

Click to download the PDB-style file with coordinates for d1ncna_.
(The format of our PDB-style files is described here.)

Timeline for d1ncna_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ncnb_