SCOPe 2.07: Domain d1nc7b1: 1nc7 B:1-114

Lineage for d1nc7b1 (1nc7 B:1-114)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.123: Hypothetical protein TM1070 [89231] (1 superfamily)
   sandwich; 8 strands in 2 sheets; jelly-roll

4. Superfamily b.123.1: Hypothetical protein TM1070 [89232] (2 families)

5. Family b.123.1.1: Hypothetical protein TM1070 [89233] (1 protein)
   automatically mapped to Pfam PF07100

6. Protein Hypothetical protein TM1070 [89234] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [89235] (1 PDB entry)

8. Domain d1nc7b1: 1nc7 B:1-114 [85550]
   Other proteins in same PDB: d1nc7a2, d1nc7a3, d1nc7b2, d1nc7c2, d1nc7d2, d1nc7d3
   structural genomics
   complexed with cl, edo, fmt, mg

Details for d1nc7b1

PDB Entry: 1nc7, 1.55 Å

PDB Description: crystal structure of thermotoga maritima 1070

PDB Compounds: (B:) hypothetical protein TM1070

SCOPe Domain Sequences for d1nc7b1:

Sequence; same for both SEQRES and ATOM records:

>d1nc7b1 b.123.1.1 (B:1-114) Hypothetical protein TM1070 {Thermotoga maritima [TaxId: 2336]}
mngarkwffpdgyipngkrgylvsheslcimntgdetakiritflfedskpvvheveisp
mkslhlrldklgipkckpysimaesnvpvvmqlsrldvgknhytlmttigywee

Timeline for d1nc7b1:

• d1nc7b1 first appeared in SCOP 1.65, called d1nc7b_
  
• d1nc7b1 appears in SCOPe 2.06
  
• d1nc7b1 appears in the current release, SCOPe 2.08