Lineage for d1nbzb2 (1nbz B:414-510)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 785070Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)
  7. 785379Species Mouse (Mus musculus) [TaxId:10090] [88576] (373 PDB entries)
    Uniprot P01864 # GCAB_MOUSE Ig gamma-2A chain C region secreted form (B allele)
    Uniprot P01863 #GCAA_MOUSE Ig gamma-2A chain C region, A allele; 86% sequence identity
    SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form)
    Uniprot P01868 # GC1_MOUSE Ig gamma-1 chain C region secreted form
    Uniprot P01864 # GCAB_MOUSE (P01864) Ig gamma-2A chain C region
    Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region
    Uniprot P01863 # GCAA_MOUSE Ig gamma-2A chain C region, A allele
    SQ NA # part of Fab 28 against HIV-1 RT
    Uniprot P01868 #
    GC1_MOUSE Ig gamma-1 chain C region secreted form
    Uniprot P01864 # GCAB_MOUSE Ig gamma-2A chain C region secreted form (B allele) ! Uniprot P01863 #GCAA_MOUSE Ig gamma-2A chain C region, A allele; 86% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form) ! Uniprot P01868 # GC1_MOUSE Ig gamma-1 chain C region secreted form ! Uniprot P01864 # GCAB_MOUSE (P01864) Ig gamma-2A chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! Uniprot P01863 # GCAA_MOUSE Ig gamma-2A chain C region, A allele ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01868 # ! GC1_MOUSE Ig gamma-1 chain C region secreted form
  8. 785436Domain d1nbzb2: 1nbz B:414-510 [85544]
    Other proteins in same PDB: d1nbza1, d1nbza2, d1nbzb1, d1nbzc_
    part of anti-lysozyme Fab HYHEL-63
    mutant

Details for d1nbzb2

PDB Entry: 1nbz (more details), 1.85 Å

PDB Description: crystal structure of hyhel-63 complexed with hel mutant k97a
PDB Compounds: (B:) immunoglobulin gamma 1 chain

SCOP Domain Sequences for d1nbzb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nbzb2 b.1.1.2 (B:414-510) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkki

SCOP Domain Coordinates for d1nbzb2:

Click to download the PDB-style file with coordinates for d1nbzb2.
(The format of our PDB-style files is described here.)

Timeline for d1nbzb2: