Lineage for d1nbzb1 (1nbz B:301-413)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1287638Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1288513Species Mouse (Mus musculus), cluster 7.2 [TaxId:10090] [88558] (31 PDB entries)
  8. 1288529Domain d1nbzb1: 1nbz B:301-413 [85543]
    Other proteins in same PDB: d1nbza1, d1nbza2, d1nbzb2, d1nbzc_
    part of anti-lysozyme Fab HYHEL-63
    mutant

Details for d1nbzb1

PDB Entry: 1nbz (more details), 1.85 Å

PDB Description: crystal structure of hyhel-63 complexed with hel mutant k97a
PDB Compounds: (B:) immunoglobulin gamma 1 chain

SCOPe Domain Sequences for d1nbzb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nbzb1 b.1.1.1 (B:301-413) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.2 [TaxId: 10090]}
evqlqesgpslvkpsqtlsltcsvtgdsvtsdywswirkfpgnkleymgyisysgstyyh
pslksrisitrdtsknqyylqlnsvttedtatyycaswggdvwgagttvtvss

SCOPe Domain Coordinates for d1nbzb1:

Click to download the PDB-style file with coordinates for d1nbzb1.
(The format of our PDB-style files is described here.)

Timeline for d1nbzb1: