SCOPe 2.01: Domain d1nbqb2: 1nbq B:130-233

Lineage for d1nbqb2 (1nbq B:130-233)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein Junction adhesion molecule, JAM, C-terminal domain [49186] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89187] (1 PDB entry)

8. Domain d1nbqb2: 1nbq B:130-233 [85535]
   Other proteins in same PDB: d1nbqa1, d1nbqb1

Details for d1nbqb2

PDB Entry: 1nbq, 2.9 Å

PDB Description: Crystal Structure of Human Junctional Adhesion Molecule Type 1

PDB Compounds: (B:) Junctional adhesion molecule 1

SCOPe Domain Sequences for d1nbqb2:

Sequence; same for both SEQRES and ATOM records:

>d1nbqb2 b.1.1.4 (B:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
vppskptvnipssatignravltcseqdgsppseytwfkdgivmptnpkstrafsnssyv
lnpttgelvfdplsasdtgeyscearngygtpmtsnavrmeave

Timeline for d1nbqb2:

• d1nbqb2 first appeared in SCOP 1.65
  
• d1nbqb2 appears in SCOP 1.75
  
• d1nbqb2 appears in SCOPe 2.02
  
• d1nbqb2 appears in the current release, SCOPe 2.08