Lineage for d1nbqa2 (1nbq A:130-233)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1109354Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 1109576Protein Junction adhesion molecule, JAM, C-terminal domain [49186] (2 species)
  7. 1109577Species Human (Homo sapiens) [TaxId:9606] [89187] (1 PDB entry)
  8. 1109578Domain d1nbqa2: 1nbq A:130-233 [85533]
    Other proteins in same PDB: d1nbqa1, d1nbqb1

Details for d1nbqa2

PDB Entry: 1nbq (more details), 2.9 Å

PDB Description: Crystal Structure of Human Junctional Adhesion Molecule Type 1
PDB Compounds: (A:) Junctional adhesion molecule 1

SCOPe Domain Sequences for d1nbqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
vppskptvnipssatignravltcseqdgsppseytwfkdgivmptnpkstrafsnssyv
lnpttgelvfdplsasdtgeyscearngygtpmtsnavrmeave

SCOPe Domain Coordinates for d1nbqa2:

Click to download the PDB-style file with coordinates for d1nbqa2.
(The format of our PDB-style files is described here.)

Timeline for d1nbqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nbqa1