SCOPe 2.08: Domain d1nbqa1: 1nbq A:27-129

Lineage for d1nbqa1 (1nbq A:27-129)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Junction adhesion molecule, JAM, N-terminal domain [48747] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89180] (1 PDB entry)

8. Domain d1nbqa1: 1nbq A:27-129 [85532]
   Other proteins in same PDB: d1nbqa2, d1nbqa3, d1nbqb2, d1nbqb3

Details for d1nbqa1

PDB Entry: 1nbq, 2.9 Å

PDB Description: Crystal Structure of Human Junctional Adhesion Molecule Type 1

PDB Compounds: (A:) Junctional adhesion molecule 1

SCOPe Domain Sequences for d1nbqa1:

Sequence; same for both SEQRES and ATOM records:

>d1nbqa1 b.1.1.1 (A:27-129) Junction adhesion molecule, JAM, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
gsvtvhssepevripennpvklscaysgfssprvewkfdqgdttrlvcynnkitasyedr
vtflptgitfksvtredtgtytcmvseeggnsygevkvklivl

Timeline for d1nbqa1:

• d1nbqa1 first appeared in SCOP 1.65
  
• d1nbqa1 appears in SCOPe 2.07