Lineage for d1nboo2 (1nbo O:149-312)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 414572Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 414573Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 414574Family d.81.1.1: GAPDH-like [55348] (3 proteins)
    has many additional secondary structures
  6. 414598Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (16 species)
  7. 414719Species Spinach (Spinacia oleracea) [TaxId:3562] [69769] (2 PDB entries)
  8. 414722Domain d1nboo2: 1nbo O:149-312 [85531]
    Other proteins in same PDB: d1nboa1, d1nbob1, d1nboo1

Details for d1nboo2

PDB Entry: 1nbo (more details), 2.6 Å

PDB Description: The dual coenzyme specificity of photosynthetic glyceraldehyde-3-phosphate dehydrogenase interpreted by the crystal structure of A4 isoform complexed with NAD

SCOP Domain Sequences for d1nboo2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nboo2 d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea)}
cttnclapfvkvldqkfgiikgtmttthsytgdqrlldashrdlrraraaclnivptstg
aakavalvlpnlkgklngialrvptpnvsvvdlvvqvskktfaeevnaafresadnelkg
ilsvcdeplvsidfrctdvsstidssltmvmgddmvkviawyd

SCOP Domain Coordinates for d1nboo2:

Click to download the PDB-style file with coordinates for d1nboo2.
(The format of our PDB-style files is described here.)

Timeline for d1nboo2: