Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) N-terminal domain is the classic Rossmann-fold |
Family d.81.1.1: GAPDH-like [55348] (4 proteins) has many additional secondary structures |
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (16 species) |
Species Spinach (Spinacia oleracea) [TaxId:3562] [69769] (5 PDB entries) |
Domain d1nbob2: 1nbo B:149-312 [85529] Other proteins in same PDB: d1nboa1, d1nbob1, d1nboo1 |
PDB Entry: 1nbo (more details), 2.6 Å
SCOP Domain Sequences for d1nbob2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nbob2 d.81.1.1 (B:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea)} cttnclapfvkvldqkfgiikgtmttthsytgdqrlldashrdlrraraaclnivptstg aakavalvlpnlkgklngialrvptpnvsvvdlvvqvskktfaeevnaafresadnelkg ilsvcdeplvsidfrctdvsstidssltmvmgddmvkviawyd
Timeline for d1nbob2:
View in 3D Domains from other chains: (mouse over for more information) d1nboa1, d1nboa2, d1nboo1, d1nboo2 |