Lineage for d1nbob1 (1nbo B:0-148,B:313-333)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 819418Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 819419Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 820760Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 820964Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species)
  7. 821123Species Spinach (Spinacia oleracea) [TaxId:3562] [69409] (8 PDB entries)
    Uniprot P19866
  8. 821134Domain d1nbob1: 1nbo B:0-148,B:313-333 [85528]
    Other proteins in same PDB: d1nboa2, d1nbob2, d1nboo2
    complexed with nad, so4

Details for d1nbob1

PDB Entry: 1nbo (more details), 2.6 Å

PDB Description: The dual coenzyme specificity of photosynthetic glyceraldehyde-3-phosphate dehydrogenase interpreted by the crystal structure of A4 isoform complexed with NAD
PDB Compounds: (B:) glyceraldehyde-3-phosphate dehydrogenase a

SCOP Domain Sequences for d1nbob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nbob1 c.2.1.3 (B:0-148,B:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]}
klkvaingfgrigrnflrcwhgrkdspldvvvindtggvkqashllkydsilgtfdadvk
tagdsaisvdgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvl
itapgkgdiptyvvgvneegythadtiisnasXnewgysqrvvdladivankwq

SCOP Domain Coordinates for d1nbob1:

Click to download the PDB-style file with coordinates for d1nbob1.
(The format of our PDB-style files is described here.)

Timeline for d1nbob1: