Lineage for d1nb9a_ (1nb9 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2062589Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2063433Superfamily b.43.5: Riboflavin kinase-like [82114] (3 families) (S)
  5. 2063434Family b.43.5.1: ATP-dependent riboflavin kinase-like [82115] (2 proteins)
    automatically mapped to Pfam PF01687
  6. 2063435Protein Riboflavin kinase [82116] (2 species)
  7. 2063444Species Human (Homo sapiens) [TaxId:9606] [89338] (5 PDB entries)
    encoded by FLJ11149
  8. 2063445Domain d1nb9a_: 1nb9 A: [85515]
    complexed with adp, mg, rbf

Details for d1nb9a_

PDB Entry: 1nb9 (more details), 1.7 Å

PDB Description: Crystal Structure of Riboflavin Kinase
PDB Compounds: (A:) hypothetical protein FLJ11149

SCOPe Domain Sequences for d1nb9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nb9a_ b.43.5.1 (A:) Riboflavin kinase {Human (Homo sapiens) [TaxId: 9606]}
rhlpyfcrgqvvrgfgrgskqlgiptanfpeqvvdnlpadistgiyygwasvgsgdvhkm
vvsigwnpyykntkksmethimhtfkedfygeilnvaivgylrpeknfdsleslisaiqg
dieeakkrlelpeylkikednffqvsk

SCOPe Domain Coordinates for d1nb9a_:

Click to download the PDB-style file with coordinates for d1nb9a_.
(The format of our PDB-style files is described here.)

Timeline for d1nb9a_: