Lineage for d1nb9a_ (1nb9 A:)
- Root: SCOP 1.65
Class b: All beta proteins [48724] (126 folds) 
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
barrel, closed; n=6, S=10; greek-key
Superfamily b.43.5: Riboflavin kinase [82114] (1 family) 
Family b.43.5.1: Riboflavin kinase [82115] (1 protein) Protein Riboflavin kinase [82116] (2 species) 
Species Human (Homo sapiens) [TaxId:9606] [89338] (3 PDB entries)
encoded by FLJ11149
Domain d1nb9a_: 1nb9 A: [85515]
complexed with adp, mg, rbf
Details for d1nb9a_
PDB Entry: 1nb9 (more details), 1.7 Å
PDB Description: Crystal Structure of Riboflavin Kinase
SCOP Domain Sequences for d1nb9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nb9a_ b.43.5.1 (A:) Riboflavin kinase {Human (Homo sapiens)}
rhlpyfcrgqvvrgfgrgskqlgiptanfpeqvvdnlpadistgiyygwasvgsgdvhkm
vvsigwnpyykntkksmethimhtfkedfygeilnvaivgylrpeknfdsleslisaiqg
dieeakkrlelpeylkikednffqvsk
SCOP Domain Coordinates for d1nb9a_:
Click to download the PDB-style file with coordinates for d1nb9a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1nb9a_:
- d1nb9a_ is new in SCOP 1.65
- d1nb9a_ appears in SCOP 1.67
- d1nb9a_ appears in the current release, SCOPe 2.08
View in 3D