Lineage for d1nb0a_ (1nb0 A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 801216Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 801665Superfamily b.43.5: Riboflavin kinase-like [82114] (2 families) (S)
  5. 801666Family b.43.5.1: ATP-dependent riboflavin kinase-like [82115] (2 proteins)
  6. 801667Protein Riboflavin kinase [82116] (2 species)
  7. 801676Species Human (Homo sapiens) [TaxId:9606] [89338] (4 PDB entries)
    encoded by FLJ11149
  8. 801678Domain d1nb0a_: 1nb0 A: [85506]
    complexed with adp, mg

Details for d1nb0a_

PDB Entry: 1nb0 (more details), 1.7 Å

PDB Description: Crystal Structure of Human Riboflavin Kinase
PDB Compounds: (A:) hypothetical protein FLJ11149

SCOP Domain Sequences for d1nb0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nb0a_ b.43.5.1 (A:) Riboflavin kinase {Human (Homo sapiens) [TaxId: 9606]}
rhlpyfcrgqvvrgfgrgskqlgiptanfpeqvvdnlpadistgiyygwasvgsgdvhkm
vvsigwnpyykntkksmethimhtfkedfygeilnvaivgylrpeknfdsleslisaiqg
dieeakkrlelpeylkikednffqvsk

SCOP Domain Coordinates for d1nb0a_:

Click to download the PDB-style file with coordinates for d1nb0a_.
(The format of our PDB-style files is described here.)

Timeline for d1nb0a_: