Lineage for d1nayc_ (1nay C:)

  1. Root: SCOP 1.67
  2. 435509Class k: Designed proteins [58788] (41 folds)
  3. 435551Fold k.3: Collagen-like peptides [58805] (1 superfamily)
  4. 435552Superfamily k.3.1: Collagen-like peptides [58806] (1 family) (S)
  5. 435553Family k.3.1.1: Collagen-like peptides [58807] (1 protein)
  6. 435554Protein Collagen-like peptides [58808] (7 species)
  7. 435594Species Synthetic, [(pro-pro-gly)10]3 triple helix model [70052] (2 PDB entries)
  8. 435603Domain d1nayc_: 1nay C: [85504]
    foldon is a trimerisation domain of T4 fibritin

Details for d1nayc_

PDB Entry: 1nay (more details), 2.6 Å

PDB Description: gpp-foldon:x-ray structure

SCOP Domain Sequences for d1nayc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nayc_ k.3.1.1 (C:) Collagen-like peptides {Synthetic, [(pro-pro-gly)10]3 triple helix model}
gppgppgppgppgppgppgppgppgppgsgyipeaprdgqayvrkdgewvllstfl

SCOP Domain Coordinates for d1nayc_:

Click to download the PDB-style file with coordinates for d1nayc_.
(The format of our PDB-style files is described here.)

Timeline for d1nayc_: