Lineage for d1naxa_ (1nax A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2729534Protein Thyroid hormone receptor beta (TR-beta) [48530] (1 species)
  7. 2729535Species Human (Homo sapiens) [TaxId:9606] [48531] (22 PDB entries)
    Uniprot P10828 202-460
  8. 2729540Domain d1naxa_: 1nax A: [85501]
    complexed with ih5

Details for d1naxa_

PDB Entry: 1nax (more details), 2.7 Å

PDB Description: Thyroid receptor beta1 in complex with a beta-selective ligand
PDB Compounds: (A:) Thyroid hormone receptor Beta-1

SCOPe Domain Sequences for d1naxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1naxa_ a.123.1.1 (A:) Thyroid hormone receptor beta (TR-beta) {Human (Homo sapiens) [TaxId: 9606]}
kpeptdeeweliktvteahvatnaqgshwkqkrkflpedigqapivnapeggkvdleafs
hftkiitpaitrvvdfakklpmfcelpcedqiillkgccmeimslraavrydpesetltl
ngemavtrgqlkngglgvvsdaifdlgmslssfnlddtevallqavllmssdrpglacve
riekyqdsfllafehyinyrkhhvthfwpkllmkvtdlrmigachasrflhmkvecptel
fpplflevfe

SCOPe Domain Coordinates for d1naxa_:

Click to download the PDB-style file with coordinates for d1naxa_.
(The format of our PDB-style files is described here.)

Timeline for d1naxa_: