SCOPe 2.04: Domain d1nanl1: 1nan L:182-278

Lineage for d1nanl1 (1nan L:182-278)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (103 PDB entries)
   Uniprot P01901 22-299

8. Domain d1nanl1: 1nan L:182-278 [85496]
   Other proteins in same PDB: d1nanh2, d1nani_, d1nanl2, d1nanp_

Details for d1nanl1

PDB Entry: 1nan, 2.3 Å

PDB Description: mch class i h-2kb molecule complexed with pbm1 peptide

PDB Compounds: (L:) h-2 class I histocompatibility antigen, k-b alpha chain

SCOPe Domain Sequences for d1nanl1:

Sequence; same for both SEQRES and ATOM records:

>d1nanl1 b.1.1.2 (L:182-278) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrweppp

Timeline for d1nanl1:

• d1nanl1 first appeared in SCOP 1.65
  
• d1nanl1 appears in SCOPe 2.03
  
• d1nanl1 appears in SCOPe 2.05
  
• d1nanl1 appears in the current release, SCOPe 2.08