SCOP 1.73: Domain d1nani_: 1nan I:

Lineage for d1nani_ (1nan I:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein beta2-microglobulin [88600] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (85 PDB entries)

8. Domain d1nani_: 1nan I: [85495]
   Other proteins in same PDB: d1nanh1, d1nanh2, d1nanl1, d1nanl2

Details for d1nani_

PDB Entry: 1nan, 2.3 Å

PDB Description: mch class i h-2kb molecule complexed with pbm1 peptide

PDB Compounds: (I:) Beta-2-microglobulin

SCOP Domain Sequences for d1nani_:

Sequence; same for both SEQRES and ATOM records:

>d1nani_ b.1.1.2 (I:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d1nani_:

• d1nani_ first appeared in SCOP 1.65
  
• d1nani_ appears in SCOP 1.71
  
• d1nani_ appears in SCOP 1.75
  
• d1nani_ appears in the current release, SCOPe 2.08