SCOPe 2.07: Domain d1namh2: 1nam H:1-181

Lineage for d1namh2 (1nam H:1-181)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (52 PDB entries)
   Uniprot P01901 22-299

8. Domain d1namh2: 1nam H:1-181 [85491]
   Other proteins in same PDB: d1nama_, d1namb_, d1namh1, d1naml1, d1naml2

Details for d1namh2

PDB Entry: 1nam, 2.7 Å

PDB Description: murine alloreactive scfv tcr-peptide-mhc class i molecule complex

PDB Compounds: (H:) h-2 class I histocompatibility antigen, k-b alpha chain precursor

SCOPe Domain Sequences for d1namh2:

Sequence; same for both SEQRES and ATOM records:

>d1namh2 d.19.1.1 (H:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB [TaxId: 10090]}
gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
r

Timeline for d1namh2:

• d1namh2 first appeared in SCOP 1.65
  
• d1namh2 appears in SCOPe 2.06
  
• d1namh2 appears in the current release, SCOPe 2.08