Class b: All beta proteins [48724] (144 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Class I MHC, alpha-3 domain [88604] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88606] (60 PDB entries) |
Domain d1namh1: 1nam H:182-275 [85490] Other proteins in same PDB: d1nama_, d1namb_, d1namh2, d1naml_ |
PDB Entry: 1nam (more details), 2.7 Å
SCOP Domain Sequences for d1namh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1namh1 b.1.1.2 (H:182-275) Class I MHC, alpha-3 domain {Mouse (Mus musculus)} tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf qkwasvvvplgkeqyytchvyhqglpepltlrwe
Timeline for d1namh1: