SCOP 1.67: Domain d1namb_: 1nam B:

Lineage for d1namb_ (1nam B:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)

6. Protein T-cell antigen receptor [48933] (6 species)
   sequences may differ within each classified species

7. Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (17 PDB entries)

8. Domain d1namb_: 1nam B: [85489]
   Other proteins in same PDB: d1namh1, d1namh2, d1naml_
   complexed with nag

Details for d1namb_

PDB Entry: 1nam, 2.7 Å

PDB Description: murine alloreactive scfv tcr-peptide-mhc class i molecule complex

SCOP Domain Sequences for d1namb_:

Sequence; same for both SEQRES and ATOM records:

>d1namb_ b.1.1.1 (B:) T-cell antigen receptor {Mouse (Mus musculus), beta-chain}
vtlleqnprwrlvprgqavnlrcilknsqypwmswyqqdlqkqlqwlftlrspgdkevks
lpgadylatrvtdtelrlqvanmsqgrtlyctcsadrvgntlyfgegsrlivv

Timeline for d1namb_:

• d1namb_ first appeared in SCOP 1.65
  
• d1namb_ appears in SCOP 1.69
  
• d1namb_ appears in the current release, SCOPe 2.08