![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins) |
![]() | Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
![]() | Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [48934] (16 PDB entries) |
![]() | Domain d1nama_: 1nam A: [85488] Other proteins in same PDB: d1namh1, d1namh2, d1naml_ complexed with nag |
PDB Entry: 1nam (more details), 2.7 Å
SCOP Domain Sequences for d1nama_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nama_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain} qkvtqtqtsisvmekttvtmdcvyetqdssyflfwykqtasgeivflirqdsykkenatv ghyslnfqkpkssigliitatqiedsavyfcamrgdyggsgnklifgtgtllsvkp
Timeline for d1nama_:
![]() Domains from other chains: (mouse over for more information) d1namb_, d1namh1, d1namh2, d1naml_ |