Lineage for d1n9za_ (1n9z A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892194Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2892195Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 2892196Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins)
  6. 2892209Protein Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) [53308] (1 species)
  7. 2892210Species Human (Homo sapiens) [TaxId:9606] [53309] (13 PDB entries)
  8. 2892221Domain d1n9za_: 1n9z A: [85478]
    complexed with mg; mutant

Details for d1n9za_

PDB Entry: 1n9z (more details), 2.5 Å

PDB Description: integrin alpha m i domain mutant
PDB Compounds: (A:) Integrin alpha-M

SCOPe Domain Sequences for d1n9za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n9za_ c.62.1.1 (A:) Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) {Human (Homo sapiens) [TaxId: 9606]}
csdiaflidgsgsiiphdfrrmkefvstvmeqlkksktlfslmqyseefrihftfkefqn
npnprslvkpitqllgrthtatgirkvvrelfnitngarknafkilvvitdgekfgdplg
yedvipeadregviryvigvgdafrseksrqelntiaskpprdhvfqvnnfealktiqnq
lrec

SCOPe Domain Coordinates for d1n9za_:

Click to download the PDB-style file with coordinates for d1n9za_.
(The format of our PDB-style files is described here.)

Timeline for d1n9za_: