Class a: All alpha proteins [46456] (202 folds) |
Fold a.118: alpha-alpha superhelix [48370] (20 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.21: Chemosensory protein Csp2 [100910] (1 family) |
Family a.118.21.1: Chemosensory protein Csp2 [81898] (1 protein) |
Protein Chemosensory protein Csp2 [81899] (1 species) |
Species Cabbage moth (Mamestra brassicae) [TaxId:55057] [81900] (5 PDB entries) |
Domain d1n8ua_: 1n8u A: [85456] complexed with bromo-dodecanol complexed with bdd |
PDB Entry: 1n8u (more details), 1.8 Å
SCOP Domain Sequences for d1n8ua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n8ua_ a.118.21.1 (A:) Chemosensory protein Csp2 {Cabbage moth (Mamestra brassicae)} kytdkydninldeilankrllvayvncvmergkcspegkelkehlqdaiengckkctenq ekgayrviehlikneieiwreltakydptgnwrkkyedra
Timeline for d1n8ua_: