Lineage for d1n8rt_ (1n8r T:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 325126Fold d.12: Ribosomal proteins L23 and L15e [54188] (1 superfamily)
    beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243
  4. 325127Superfamily d.12.1: Ribosomal proteins L23 and L15e [54189] (2 families) (S)
  5. 325128Family d.12.1.1: L23p [54190] (1 protein)
  6. 325129Protein Ribosomal protein L23 [54191] (2 species)
  7. 325130Species Archaeon Haloarcula marismortui [TaxId:2238] [54192] (12 PDB entries)
  8. 325137Domain d1n8rt_: 1n8r T: [85447]
    Other proteins in same PDB: d1n8r1_, d1n8r2_, d1n8r3_, d1n8r4_, d1n8rc1, d1n8rc2, d1n8rd_, d1n8re_, d1n8rf_, d1n8rg1, d1n8rg2, d1n8rh_, d1n8ri_, d1n8rj_, d1n8rk_, d1n8rl_, d1n8rm_, d1n8rn_, d1n8ro_, d1n8rp_, d1n8rq_, d1n8rr_, d1n8rs_, d1n8ru_, d1n8rv_, d1n8rw_, d1n8rx_, d1n8ry_, d1n8rz_
    complexed with cd, cl, k, mg, na, vir; mutant

Details for d1n8rt_

PDB Entry: 1n8r (more details), 3 Å

PDB Description: Structure of large ribosomal subunit in complex with virginiamycin M

SCOP Domain Sequences for d1n8rt_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n8rt_ d.12.1.1 (T:) Ribosomal protein L23 {Archaeon Haloarcula marismortui}
swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg
ekkavvrlsedddaqevasri

SCOP Domain Coordinates for d1n8rt_:

Click to download the PDB-style file with coordinates for d1n8rt_.
(The format of our PDB-style files is described here.)

Timeline for d1n8rt_: