Lineage for d1n8rp_ (1n8r P:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 480304Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily)
    core: three turns of irregular (beta-beta-alpha)n superhelix
  4. 480305Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) (S)
  5. 480306Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins)
  6. 480328Protein Ribosomal protein L18e [52084] (1 species)
  7. 480329Species Archaeon Haloarcula marismortui [TaxId:2238] [52085] (19 PDB entries)
  8. 480345Domain d1n8rp_: 1n8r P: [85443]
    Other proteins in same PDB: d1n8r1_, d1n8r2_, d1n8r3_, d1n8r4_, d1n8rc1, d1n8rc2, d1n8rd_, d1n8re_, d1n8rf_, d1n8rg1, d1n8rg2, d1n8rh_, d1n8ri_, d1n8rj_, d1n8rk_, d1n8rl_, d1n8rm_, d1n8rn_, d1n8ro_, d1n8rq_, d1n8rr_, d1n8rs_, d1n8rt_, d1n8ru_, d1n8rv_, d1n8rw_, d1n8rx_, d1n8ry_, d1n8rz_

Details for d1n8rp_

PDB Entry: 1n8r (more details), 3 Å

PDB Description: Structure of large ribosomal subunit in complex with virginiamycin M

SCOP Domain Sequences for d1n8rp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n8rp_ c.12.1.1 (P:) Ribosomal protein L18e {Archaeon Haloarcula marismortui}
sktnprlssliadlksaarssggavwgdvaerlekprrthaevnlgrieryaqedetvvv
pgkvlgsgvlqkdvtvaavdfsgtaetkidqvgeavsleqaiennpegshvrvir

SCOP Domain Coordinates for d1n8rp_:

Click to download the PDB-style file with coordinates for d1n8rp_.
(The format of our PDB-style files is described here.)

Timeline for d1n8rp_: