Lineage for d1n8ri_ (1n8r I:)

  1. Root: SCOP 1.71
  2. 629440Class j: Peptides [58231] (116 folds)
  3. 630773Fold j.84: Ribosomal protein L10 [64658] (1 superfamily)
  4. 630774Superfamily j.84.1: Ribosomal protein L10 [64659] (1 family) (S)
  5. 630775Family j.84.1.1: Ribosomal protein L10 [64660] (1 protein)
  6. 630776Protein Ribosomal protein L10 [64661] (1 species)
    two alpha-helical segments visible in the crystal structure
  7. 630777Species Archaeon Haloarcula marismortui [TaxId:2238] [64662] (18 PDB entries)
  8. 630792Domain d1n8ri_: 1n8r I: [85436]
    Other proteins in same PDB: d1n8r1_, d1n8r2_, d1n8r3_, d1n8r4_, d1n8rc1, d1n8rc2, d1n8rd_, d1n8re_, d1n8rf_, d1n8rg1, d1n8rg2, d1n8rh_, d1n8rj_, d1n8rk_, d1n8rl_, d1n8rm_, d1n8rn_, d1n8ro_, d1n8rp_, d1n8rq_, d1n8rr_, d1n8rs_, d1n8rt_, d1n8ru_, d1n8rv_, d1n8rw_, d1n8rx_, d1n8ry_, d1n8rz_
    complexed with cd, cl, k, mg, na, vir; mutant

Details for d1n8ri_

PDB Entry: 1n8r (more details), 3 Å

PDB Description: Structure of large ribosomal subunit in complex with virginiamycin M

SCOP Domain Sequences for d1n8ri_:

Sequence, based on SEQRES records: (download)

>d1n8ri_ j.84.1.1 (I:) Ribosomal protein L10 {Archaeon Haloarcula marismortui}
ipewkqeevdaivemiesyesvgvvniagipsrqlqdmrrdlhgtaelrvsrntlleral
dd

Sequence, based on observed residues (ATOM records): (download)

>d1n8ri_ j.84.1.1 (I:) Ribosomal protein L10 {Archaeon Haloarcula marismortui}
ipewkqeevdaivemiesrntlleraldd

SCOP Domain Coordinates for d1n8ri_:

Click to download the PDB-style file with coordinates for d1n8ri_.
(The format of our PDB-style files is described here.)

Timeline for d1n8ri_: