Lineage for d1n8rh_ (1n8r H:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 506461Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 506595Superfamily d.79.3: L30e-like [55315] (3 families) (S)
  5. 506596Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (3 proteins)
  6. 506613Protein Ribosomal protein L7ae [55319] (4 species)
  7. 506617Species Archaeon Haloarcula marismortui [TaxId:2238] [55320] (19 PDB entries)
  8. 506633Domain d1n8rh_: 1n8r H: [85435]
    Other proteins in same PDB: d1n8r1_, d1n8r2_, d1n8r3_, d1n8r4_, d1n8rc1, d1n8rc2, d1n8rd_, d1n8re_, d1n8rf_, d1n8rg1, d1n8rg2, d1n8ri_, d1n8rj_, d1n8rk_, d1n8rl_, d1n8rm_, d1n8rn_, d1n8ro_, d1n8rp_, d1n8rq_, d1n8rr_, d1n8rs_, d1n8rt_, d1n8ru_, d1n8rv_, d1n8rw_, d1n8rx_, d1n8ry_, d1n8rz_

Details for d1n8rh_

PDB Entry: 1n8r (more details), 3 Å

PDB Description: Structure of large ribosomal subunit in complex with virginiamycin M

SCOP Domain Sequences for d1n8rh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n8rh_ d.79.3.1 (H:) Ribosomal protein L7ae {Archaeon Haloarcula marismortui}
pvyvdfdvpadleddalealevardtgavkkgtnettksiergsaelvfvaedvqpeeiv
mhipeladekgvpfifveqqddlghaaglevgsaaaavtdagaaatvleeiadkveelr

SCOP Domain Coordinates for d1n8rh_:

Click to download the PDB-style file with coordinates for d1n8rh_.
(The format of our PDB-style files is described here.)

Timeline for d1n8rh_: