SCOP 1.65: Domain d1n8fd_: 1n8f D:

Lineage for d1n8fd_ (1n8f D:)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (5 families)
   Common fold covers whole protein structure

5. Family c.1.10.4: Class I DAHP synthetase [51599] (2 proteins)

6. Protein 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) [51600] (2 species)

7. Species Escherichia coli, phenylalanine-regulated isozyme [TaxId:562] [51601] (4 PDB entries)

8. Domain d1n8fd_: 1n8f D: [85400]
   complexed with mn, pep, so4; mutant

Details for d1n8fd_

PDB Entry: 1n8f, 1.75 Å

PDB Description: crystal structure of e24q mutant of phenylalanine-regulated 3-deoxy-d- arabino-heptulosonate-7-phosphate synthase (dahp synthase) from escherichia coli in complex with mn2+ and pep

SCOP Domain Sequences for d1n8fd_:

Sequence; same for both SEQRES and ATOM records:

>d1n8fd_ c.1.10.4 (D:) 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) {Escherichia coli, phenylalanine-regulated isozyme}
lrikeikellppvallqkfpatenaantvaharkaihkilkgnddrllvvigpcsihdpv
aakeyatrllalreelkdeleivmrvyfekprttvgwkglindphmdnsfqindglriar
kllldindsglpaagefldmitpqyladlmswgaigarttesqvhrelasglscpvgfkn
gtdgtikvaidainaagaphcflsvtkwghsaivntsgngdchiilrggkepnysakhva
evkeglnkaglpaqvmidfshansskqfkkqmdvcadvcqqiaggekaiigvmveshlve
gnqslesgeplaygksitdacigwedtdallrqlanavkarrg

Timeline for d1n8fd_:

• d1n8fd_ is new in SCOP 1.65
  
• d1n8fd_ appears in SCOP 1.67
  
• d1n8fd_ appears in the current release, SCOPe 2.08