Lineage for d1n8fd_ (1n8f D:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 305036Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 306689Superfamily c.1.10: Aldolase [51569] (5 families) (S)
    Common fold covers whole protein structure
  5. 306927Family c.1.10.4: Class I DAHP synthetase [51599] (2 proteins)
  6. 306928Protein 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) [51600] (2 species)
  7. 306929Species Escherichia coli, phenylalanine-regulated isozyme [TaxId:562] [51601] (4 PDB entries)
  8. 306933Domain d1n8fd_: 1n8f D: [85400]
    complexed with mn, pep, so4; mutant

Details for d1n8fd_

PDB Entry: 1n8f (more details), 1.75 Å

PDB Description: Crystal structure of E24Q mutant of phenylalanine-regulated 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase) from Escherichia Coli in complex with Mn2+ and PEP

SCOP Domain Sequences for d1n8fd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n8fd_ c.1.10.4 (D:) 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase (DAHP synthase, AroG) {Escherichia coli, phenylalanine-regulated isozyme}
lrikeikellppvallqkfpatenaantvaharkaihkilkgnddrllvvigpcsihdpv
aakeyatrllalreelkdeleivmrvyfekprttvgwkglindphmdnsfqindglriar
kllldindsglpaagefldmitpqyladlmswgaigarttesqvhrelasglscpvgfkn
gtdgtikvaidainaagaphcflsvtkwghsaivntsgngdchiilrggkepnysakhva
evkeglnkaglpaqvmidfshansskqfkkqmdvcadvcqqiaggekaiigvmveshlve
gnqslesgeplaygksitdacigwedtdallrqlanavkarrg

SCOP Domain Coordinates for d1n8fd_:

Click to download the PDB-style file with coordinates for d1n8fd_.
(The format of our PDB-style files is described here.)

Timeline for d1n8fd_: