Lineage for d1n88a_ (1n88 A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 325126Fold d.12: Ribosomal proteins L23 and L15e [54188] (1 superfamily)
    beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243
  4. 325127Superfamily d.12.1: Ribosomal proteins L23 and L15e [54189] (2 families) (S)
  5. 325128Family d.12.1.1: L23p [54190] (1 protein)
  6. 325129Protein Ribosomal protein L23 [54191] (2 species)
  7. 325143Species Thermus thermophilus [TaxId:274] [89815] (1 PDB entry)
  8. 325144Domain d1n88a_: 1n88 A: [85391]

Details for d1n88a_

PDB Entry: 1n88 (more details)

PDB Description: nmr structure of the ribosomal protein l23 from thermus thermophilus.

SCOP Domain Sequences for d1n88a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n88a_ d.12.1.1 (A:) Ribosomal protein L23 {Thermus thermophilus}
mktaydvilapvlsekayagfaegkytfwvhpkatkteiknavetafkvkvvkvntlhvr
gkkkrlgrylgkrpdrkkaivqvapgqkiealegli

SCOP Domain Coordinates for d1n88a_:

Click to download the PDB-style file with coordinates for d1n88a_.
(The format of our PDB-style files is described here.)

Timeline for d1n88a_: