Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
Fold d.12: Ribosomal proteins L23 and L15e [54188] (1 superfamily) beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243 |
Superfamily d.12.1: Ribosomal proteins L23 and L15e [54189] (2 families) |
Family d.12.1.1: L23p [54190] (1 protein) |
Protein Ribosomal protein L23 [54191] (2 species) |
Species Thermus thermophilus [TaxId:274] [89815] (1 PDB entry) |
Domain d1n88a_: 1n88 A: [85391] |
PDB Entry: 1n88 (more details)
SCOP Domain Sequences for d1n88a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n88a_ d.12.1.1 (A:) Ribosomal protein L23 {Thermus thermophilus} mktaydvilapvlsekayagfaegkytfwvhpkatkteiknavetafkvkvvkvntlhvr gkkkrlgrylgkrpdrkkaivqvapgqkiealegli
Timeline for d1n88a_: