Lineage for d1n67a1 (1n67 A:229-369)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2376992Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2377239Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 2377547Family b.2.3.4: Fibrinogen-binding domain [89210] (2 proteins)
    duplication: contains two differently decorated domains of this fold
  6. 2377548Protein Clumping factor A [89211] (1 species)
  7. 2377549Species Staphylococcus aureus [TaxId:1280] [89212] (1 PDB entry)
  8. 2377550Domain d1n67a1: 1n67 A:229-369 [85354]
    Other proteins in same PDB: d1n67a3
    complexed with mg

Details for d1n67a1

PDB Entry: 1n67 (more details), 1.9 Å

PDB Description: clumping factor a from staphylococcus aureus
PDB Compounds: (A:) Clumping Factor

SCOPe Domain Sequences for d1n67a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n67a1 b.2.3.4 (A:229-369) Clumping factor A {Staphylococcus aureus [TaxId: 1280]}
gtditnqltnvtvgidsgttvyphqagyvklnygfsvpnsavkgdtfkitvpkelnlngv
tstakvppimagdqvlangvidsdgnviytftdyvntkddvkatltmpayidpenvkktg
nvtlatgigsttanktvlvdy

SCOPe Domain Coordinates for d1n67a1:

Click to download the PDB-style file with coordinates for d1n67a1.
(The format of our PDB-style files is described here.)

Timeline for d1n67a1: