Lineage for d1n5xb3 (1n5x B:537-694)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2188935Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 2188936Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (2 families) (S)
  5. 2188937Family d.41.1.1: CO dehydrogenase molybdoprotein N-domain-like [54666] (6 proteins)
  6. 2188999Protein Xanthine oxidase, domain 5 (?) [54670] (1 species)
  7. 2189000Species Cow (Bos taurus) [TaxId:9913] [54671] (11 PDB entries)
    Uniprot P80457
  8. 2189021Domain d1n5xb3: 1n5x B:537-694 [85350]
    Other proteins in same PDB: d1n5xa1, d1n5xa2, d1n5xa4, d1n5xa5, d1n5xa6, d1n5xb1, d1n5xb2, d1n5xb4, d1n5xb5, d1n5xb6
    complexed with fad, fes, mos, mte, tei

Details for d1n5xb3

PDB Entry: 1n5x (more details), 2.8 Å

PDB Description: Xanthine Dehydrogenase from Bovine Milk with Inhibitor TEI-6720 Bound
PDB Compounds: (B:) Xanthine Dehydrogenase

SCOPe Domain Sequences for d1n5xb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n5xb3 d.41.1.1 (B:537-694) Xanthine oxidase, domain 5 (?) {Cow (Bos taurus) [TaxId: 9913]}
kldptytsatllfqkhppaniqlfqevpngqskedtvgrplphlaaamqasgeavycddi
pryenelflrlvtstrahakiksidvseaqkvpgfvcflsaddipgsnetglfndetvfa
kdtvtcvghiigavvadtpehaeraahvvkvtyedlpa

SCOPe Domain Coordinates for d1n5xb3:

Click to download the PDB-style file with coordinates for d1n5xb3.
(The format of our PDB-style files is described here.)

Timeline for d1n5xb3: