Lineage for d1n5xa2 (1n5x A:3-92)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2933780Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2933988Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)
  6. 2934134Protein Xanthine oxidase, N-terminal domain [54318] (1 species)
  7. 2934135Species Cow (Bos taurus) [TaxId:9913] [54319] (11 PDB entries)
    Uniprot P80457
  8. 2934154Domain d1n5xa2: 1n5x A:3-92 [85343]
    Other proteins in same PDB: d1n5xa1, d1n5xa3, d1n5xa4, d1n5xa5, d1n5xa6, d1n5xb1, d1n5xb3, d1n5xb4, d1n5xb5, d1n5xb6
    complexed with fad, fes, mos, mte, tei

Details for d1n5xa2

PDB Entry: 1n5x (more details), 2.8 Å

PDB Description: Xanthine Dehydrogenase from Bovine Milk with Inhibitor TEI-6720 Bound
PDB Compounds: (A:) Xanthine Dehydrogenase

SCOPe Domain Sequences for d1n5xa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n5xa2 d.15.4.2 (A:3-92) Xanthine oxidase, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
adelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrlq
dkiihfsanaclapictlhhvavttvegig

SCOPe Domain Coordinates for d1n5xa2:

Click to download the PDB-style file with coordinates for d1n5xa2.
(The format of our PDB-style files is described here.)

Timeline for d1n5xa2: