Lineage for d1n5xa1 (1n5x A:93-165)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000915Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
    core: 4 helices, bundle
  4. 2000916Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families) (S)
    contains 2Fe-2S cluster
  5. 2000917Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (7 proteins)
  6. 2000976Protein Xanthine oxidase, domain 2 [47746] (1 species)
  7. 2000977Species Cow (Bos taurus) [TaxId:9913] [47747] (11 PDB entries)
    Uniprot P80457
  8. 2000997Domain d1n5xa1: 1n5x A:93-165 [85342]
    Other proteins in same PDB: d1n5xa2, d1n5xa3, d1n5xa4, d1n5xa5, d1n5xa6, d1n5xb2, d1n5xb3, d1n5xb4, d1n5xb5, d1n5xb6
    complexed with fad, fes, mos, mte, tei

Details for d1n5xa1

PDB Entry: 1n5x (more details), 2.8 Å

PDB Description: Xanthine Dehydrogenase from Bovine Milk with Inhibitor TEI-6720 Bound
PDB Compounds: (A:) Xanthine Dehydrogenase

SCOPe Domain Sequences for d1n5xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n5xa1 a.56.1.1 (A:93-165) Xanthine oxidase, domain 2 {Cow (Bos taurus) [TaxId: 9913]}
stktrlhpvqeriakshgsqcgfctpgivmsmytllrnqpeptveeiedafqgnlcrctg
yrpilqgfrtfak

SCOPe Domain Coordinates for d1n5xa1:

Click to download the PDB-style file with coordinates for d1n5xa1.
(The format of our PDB-style files is described here.)

Timeline for d1n5xa1: