SCOP 1.73: Domain d1n4xm_: 1n4x M:

Lineage for d1n4xm_ (1n4x M:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (127 PDB entries)

8. Domain d1n4xm_: 1n4x M: [85327]
   Other proteins in same PDB: d1n4xh_, d1n4xi_
   part of scFv 1695
   complexed with cl

Details for d1n4xm_

PDB Entry: 1n4x, 1.7 Å

PDB Description: structure of scfv 1696 at acidic ph

PDB Compounds: (M:) immunoglobulin kappa chain variable region

SCOP Domain Sequences for d1n4xm_:

Sequence; same for both SEQRES and ATOM records:

>d1n4xm_ b.1.1.1 (M:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]}
mdilmtqtplylpvslgdqasiscrssqtivhnngntylewylqkpgqspqlliykvsnr
fsgvpdrfsgsgsgtdftlkisrveaedlgiyycfqgshfpptfgggtkleia

Timeline for d1n4xm_:

• d1n4xm_ first appeared in SCOP 1.65
  
• d1n4xm_ appears in SCOP 1.71
  
• d1n4xm_ appears in SCOP 1.75
  
• d1n4xm_ appears in the current release, SCOPe 2.08, called d1n4xm1