Lineage for d1n4xl_ (1n4x L:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1511401Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1511624Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (131 PDB entries)
    Uniprot P01631 #KV2G_MOUSE Ig kappa chain V-II region 26-10; 79% sequence identity ! Uniprot P06310 # KV2F_HUMAN IG KAPPA CHAIN V-II REGION RPMI 6410 PRECURSOR ! Uniprot P03976 # KV2E_MOUSE (P03976) Ig kappa chain V-II region 17S29.1 ! Uniprot P01642 21-115 # ! KV2G_MOUSE IG KAPPA CHAIN V-II REGION 26-10
  8. 1511637Domain d1n4xl_: 1n4x L: [85326]
    Other proteins in same PDB: d1n4xh_, d1n4xi_
    part of scFv 1695
    complexed with cl

Details for d1n4xl_

PDB Entry: 1n4x (more details), 1.7 Å

PDB Description: structure of scfv 1696 at acidic ph
PDB Compounds: (L:) immunoglobulin kappa chain variable region

SCOPe Domain Sequences for d1n4xl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n4xl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]}
mdilmtqtplylpvslgdqasiscrssqtivhnngntylewylqkpgqspqlliykvsnr
fsgvpdrfsgsgsgtdftlkisrveaedlgiyycfqgshfpptfgggtkleia

SCOPe Domain Coordinates for d1n4xl_:

Click to download the PDB-style file with coordinates for d1n4xl_.
(The format of our PDB-style files is described here.)

Timeline for d1n4xl_: