Lineage for d1n4xl_ (1n4x L:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 287738Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogeneous CDRs are listed as engineered species
  7. 287841Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (98 PDB entries)
  8. 287845Domain d1n4xl_: 1n4x L: [85326]
    Other proteins in same PDB: d1n4xh_, d1n4xi_

Details for d1n4xl_

PDB Entry: 1n4x (more details), 1.7 Å

PDB Description: structure of scfv 1696 at acidic ph

SCOP Domain Sequences for d1n4xl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n4xl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1}
mdilmtqtplylpvslgdqasiscrssqtivhnngntylewylqkpgqspqlliykvsnr
fsgvpdrfsgsgsgtdftlkisrveaedlgiyycfqgshfpptfgggtkleia

SCOP Domain Coordinates for d1n4xl_:

Click to download the PDB-style file with coordinates for d1n4xl_.
(The format of our PDB-style files is described here.)

Timeline for d1n4xl_: